PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G36030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 209aa    MW: 22638.8 Da    PI: 9.4977
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G36030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.21.2e-191152344
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     i n + r vt++kR++g++KKA EL +LC+++vav+ ++++g
  LPERR01G36030.1 11 IANRRTRAVTYTKRKEGLMKKARELATLCGVQVAVVCAGPDG 52
                     8899************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.026161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-21185IPR002100Transcription factor, MADS-box
CDDcd002661.46E-29385No hitNo description
PRINTSPR004041.3E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-181152IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MPRRRVPMTL IANRRTRAVT YTKRKEGLMK KARELATLCG VQVAVVCAGP DGAAPDVWTT  60
PPKNDEDASV IDKYLALPVE KRAKHTRVDY LRELLGNKKA DLAKLQQEGP DELKPPKTVL  120
DRMSQDELQQ LLGSIDATLQ ATAERRKTLE LMAAAGGDSG GDRRDADVPP MHLAVPCTGT  180
TSAGVQGYQH QVHATCNPSR SSSSTSTPA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640115.13e-57PREDICTED: uncharacterized protein LOC4324340
TrEMBLA0A0D9V9F41e-152A0A0D9V9F4_9ORYZ; Uncharacterized protein
STRINGOB01G50150.12e-63(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.13e-15AGAMOUS-like 38